Lineage for d3mw9e1 (3mw9 E:209-501)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453553Protein Glutamate dehydrogenase [51884] (8 species)
  7. 2453561Species Cow (Bos taurus) [TaxId:9913] [51889] (8 PDB entries)
  8. 2453572Domain d3mw9e1: 3mw9 E:209-501 [181642]
    Other proteins in same PDB: d3mw9a2, d3mw9b2, d3mw9c2, d3mw9d2, d3mw9e2, d3mw9f2
    complexed with glu, gtp, nai

Details for d3mw9e1

PDB Entry: 3mw9 (more details), 2.4 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate
PDB Compounds: (E:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d3mw9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mw9e1 c.2.1.7 (E:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kcitvgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlnn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d3mw9e1:

Click to download the PDB-style file with coordinates for d3mw9e1.
(The format of our PDB-style files is described here.)

Timeline for d3mw9e1: