Lineage for d1anwa_ (1anw A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643637Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 643638Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 643639Family a.65.1.1: Annexin [47875] (9 proteins)
  6. 643665Protein Annexin V [47883] (3 species)
  7. 643668Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 643679Domain d1anwa_: 1anw A: [18164]

Details for d1anwa_

PDB Entry: 1anw (more details), 2.5 Å

PDB Description: the effect of metal binding on the structure of annexin v and implications for membrane binding
PDB Compounds: (A:) annexin v

SCOP Domain Sequences for d1anwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anwa_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
gdtsgdykkallllcgedd

SCOP Domain Coordinates for d1anwa_:

Click to download the PDB-style file with coordinates for d1anwa_.
(The format of our PDB-style files is described here.)

Timeline for d1anwa_: