SCOPe 2.07: Domain d3mw9a2: 3mw9 A:1-208

Lineage for d3mw9a2 (3mw9 A:1-208)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries)

8. Domain d3mw9a2: 3mw9 A:1-208 [181635]
   Other proteins in same PDB: d3mw9a1, d3mw9b1, d3mw9c1, d3mw9d1, d3mw9e1, d3mw9f1
   complexed with glu, gtp, nai

Details for d3mw9a2

PDB Entry: 3mw9, 2.4 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate

PDB Compounds: (A:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d3mw9a2:

Sequence; same for both SEQRES and ATOM records:

>d3mw9a2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d3mw9a2:

• d3mw9a2 first appeared in SCOPe 2.01
  
• d3mw9a2 appears in SCOPe 2.06
  
• d3mw9a2 does not appear in SCOPe 2.08