Lineage for d3mw9a2 (3mw9 A:1-208)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998236Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 998237Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 998238Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 998239Protein Glutamate dehydrogenase [53225] (8 species)
  7. 998247Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 998248Domain d3mw9a2: 3mw9 A:1-208 [181635]
    Other proteins in same PDB: d3mw9a1, d3mw9b1, d3mw9c1, d3mw9d1, d3mw9e1, d3mw9f1
    complexed with glu, gtp, nad

Details for d3mw9a2

PDB Entry: 3mw9 (more details), 2.4 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate
PDB Compounds: (A:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d3mw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mw9a2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d3mw9a2:

Click to download the PDB-style file with coordinates for d3mw9a2.
(The format of our PDB-style files is described here.)

Timeline for d3mw9a2: