Lineage for d3mw9a1 (3mw9 A:209-501)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153510Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1153511Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1153519Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
  8. 1153520Domain d3mw9a1: 3mw9 A:209-501 [181634]
    Other proteins in same PDB: d3mw9a2, d3mw9b2, d3mw9c2, d3mw9d2, d3mw9e2, d3mw9f2
    complexed with glu, gtp, nad

Details for d3mw9a1

PDB Entry: 3mw9 (more details), 2.4 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate
PDB Compounds: (A:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d3mw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mw9a1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kcitvgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlnn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d3mw9a1:

Click to download the PDB-style file with coordinates for d3mw9a1.
(The format of our PDB-style files is described here.)

Timeline for d3mw9a1: