Lineage for d1anxc_ (1anx C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717120Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 2717124Domain d1anxc_: 1anx C: [18163]
    complexed with ca, so4

Details for d1anxc_

PDB Entry: 1anx (more details), 1.9 Å

PDB Description: the crystal structure of a new high-calcium form of annexin v
PDB Compounds: (C:) annexin v

SCOPe Domain Sequences for d1anxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anxc_ a.65.1.1 (C:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcge

SCOPe Domain Coordinates for d1anxc_:

Click to download the PDB-style file with coordinates for d1anxc_.
(The format of our PDB-style files is described here.)

Timeline for d1anxc_: