SCOPe 2.06: Domain d3mw4b1: 3mw4 B:83-256

Lineage for d3mw4b1 (3mw4 B:83-256)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein automated matches [190380] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188387] (8 PDB entries)

8. Domain d3mw4b1: 3mw4 B:83-256 [181627]
   Other proteins in same PDB: d3mw4a2, d3mw4b2, d3mw4c2
   automated match to d3b3qe1
   complexed with ca, so4

Details for d3mw4b1

PDB Entry: 3mw4, 2 Å

PDB Description: crystal structure of beta-neurexin 3 without the splice insert 4

PDB Compounds: (B:) Neurexin-2-beta

SCOPe Domain Sequences for d3mw4b1:

Sequence; same for both SEQRES and ATOM records:

>d3mw4b1 b.29.1.4 (B:83-256) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
atyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflqlhie
qgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehyptgrql
tifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv

Timeline for d3mw4b1:

• d3mw4b1 first appeared in SCOPe 2.01, called d3mw4b_
  
• d3mw4b1 was called d3mw4b_ in SCOPe 2.05
  
• d3mw4b1 appears in SCOPe 2.07
  
• d3mw4b1 appears in the current release, SCOPe 2.08