Lineage for d3mw3a1 (3mw3 A:87-290)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043221Family b.29.1.4: Laminin G-like module [49944] (7 protein domains)
  6. 2043303Protein automated matches [190380] (2 species)
    not a true protein
  7. 2043314Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries)
  8. 2043315Domain d3mw3a1: 3mw3 A:87-290 [181625]
    Other proteins in same PDB: d3mw3a2
    automated match to d3b3qe1
    complexed with ca

Details for d3mw3a1

PDB Entry: 3mw3 (more details), 2.33 Å

PDB Description: crystal structure of beta-neurexin 2 with the splice insert 4
PDB Compounds: (A:) Neurexin-2-beta

SCOPe Domain Sequences for d3mw3a1:

Sequence, based on SEQRES records: (download)

>d3mw3a1 b.29.1.4 (A:87-290) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnerypagnfd
nerlaiarqripyrlgrvvdewlldkgrqltifnsqatikiggrdqgrpfqgqvsglyyn
glkvlalaaesdpnvrteghlrlv

Sequence, based on observed residues (ATOM records): (download)

>d3mw3a1 b.29.1.4 (A:87-290) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnrqripyrlg
rvvdewlldkgrqltifnsqatikiggrdqgrpfqgqvsglyynglkvlalaaesdpnvr
teghlrlv

SCOPe Domain Coordinates for d3mw3a1:

Click to download the PDB-style file with coordinates for d3mw3a1.
(The format of our PDB-style files is described here.)

Timeline for d3mw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mw3a2