Lineage for d3mw0b_ (3mw0 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185928Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 1185929Species Escherichia coli [TaxId:562] [102695] (15 PDB entries)
  8. 1185951Domain d3mw0b_: 3mw0 B: [181621]
    automated match to d1zlqa1
    complexed with bhr, dtd, fe

Details for d3mw0b_

PDB Entry: 3mw0 (more details), 2.3 Å

PDB Description: X-ray structure of the doubly hydroxylated iron complex-NikA species, NikA1/O2
PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mw0b_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikp

SCOPe Domain Coordinates for d3mw0b_:

Click to download the PDB-style file with coordinates for d3mw0b_.
(The format of our PDB-style files is described here.)

Timeline for d3mw0b_: