SCOPe 2.08: Domain d1anxb_: 1anx B:

Lineage for d1anxb_ (1anx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1anxb_: 1anx B: [18162]
   complexed with ca, so4

Details for d1anxb_

PDB Entry: 1anx, 1.9 Å

PDB Description: the crystal structure of a new high-calcium form of annexin v

PDB Compounds: (B:) annexin v

SCOPe Domain Sequences for d1anxb_:

Sequence; same for both SEQRES and ATOM records:

>d1anxb_ a.65.1.1 (B:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcge

Timeline for d1anxb_:

• d1anxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1anxb_ appears in SCOPe 2.07