Lineage for d1anxb_ (1anx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325642Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2325643Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2325644Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2325672Protein Annexin V [47883] (3 species)
  7. 2325677Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 2325680Domain d1anxb_: 1anx B: [18162]
    complexed with ca, so4

Details for d1anxb_

PDB Entry: 1anx (more details), 1.9 Å

PDB Description: the crystal structure of a new high-calcium form of annexin v
PDB Compounds: (B:) annexin v

SCOPe Domain Sequences for d1anxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anxb_ a.65.1.1 (B:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcge

SCOPe Domain Coordinates for d1anxb_:

Click to download the PDB-style file with coordinates for d1anxb_.
(The format of our PDB-style files is described here.)

Timeline for d1anxb_: