SCOPe 2.01: Domain d3mvzb_: 3mvz B:

Lineage for d3mvzb_ (3mvz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (14 PDB entries)

8. Domain d3mvzb_: 3mvz B: [181619]
   automated match to d1zlqa1
   complexed with act, bhn, fe, gol, per, so4

Details for d3mvzb_

PDB Entry: 3mvz, 1.7 Å

PDB Description: X-ray structure of the (hydro)peroxo intermediate NikA/1-Int", after monohydroxylation of the iron complex

PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mvzb_:

Sequence; same for both SEQRES and ATOM records:

>d3mvzb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikp

Timeline for d3mvzb_:

• d3mvzb_ is new in SCOPe 2.01-stable
  
• d3mvzb_ appears in SCOPe 2.02
  
• d3mvzb_ appears in the current release, SCOPe 2.08