Lineage for d3mvza_ (3mvz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144986Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2144991Species Escherichia coli [TaxId:562] [102695] (20 PDB entries)
  8. 2144997Domain d3mvza_: 3mvz A: [181618]
    automated match to d1zlqa1
    complexed with act, bhn, fe, gol, per, so4

Details for d3mvza_

PDB Entry: 3mvz (more details), 1.7 Å

PDB Description: X-ray structure of the (hydro)peroxo intermediate NikA/1-Int", after monohydroxylation of the iron complex
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvza_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

SCOPe Domain Coordinates for d3mvza_:

Click to download the PDB-style file with coordinates for d3mvza_.
(The format of our PDB-style files is described here.)

Timeline for d3mvza_: