SCOPe 2.07: Domain d3mvyb_: 3mvy B:

Lineage for d3mvyb_ (3mvy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (28 PDB entries)

8. Domain d3mvyb_: 3mvy B: [181617]
   automated match to d1zlqa1
   complexed with act, bhz, cl, fe, gol, per, so4

Details for d3mvyb_

PDB Entry: 3mvy, 2.5 Å

PDB Description: X-ray structure of the diatomic oxo-intermediate NikA/1-Int', prior hydroxylation

PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mvyb_:

Sequence; same for both SEQRES and ATOM records:

>d3mvyb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikp

Timeline for d3mvyb_:

• d3mvyb_ first appeared in SCOPe 2.01
  
• d3mvyb_ appears in SCOPe 2.06
  
• d3mvyb_ appears in the current release, SCOPe 2.08