SCOPe 2.03: Domain d3mvya_: 3mvy A:

Lineage for d3mvya_ (3mvy A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (18 PDB entries)

8. Domain d3mvya_: 3mvy A: [181616]
   automated match to d1zlqa1
   complexed with act, bhz, cl, fe, gol, per, so4

Details for d3mvya_

PDB Entry: 3mvy, 2.5 Å

PDB Description: X-ray structure of the diatomic oxo-intermediate NikA/1-Int', prior hydroxylation

PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mvya_:

Sequence; same for both SEQRES and ATOM records:

>d3mvya_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

Timeline for d3mvya_:

• d3mvya_ first appeared in SCOPe 2.01
  
• d3mvya_ appears in SCOPe 2.02
  
• d3mvya_ appears in SCOPe 2.04
  
• d3mvya_ appears in the current release, SCOPe 2.08