Lineage for d3mvxa_ (3mvx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144986Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2144991Species Escherichia coli [TaxId:562] [102695] (20 PDB entries)
  8. 2144995Domain d3mvxa_: 3mvx A: [181614]
    automated match to d1zlqa1
    complexed with act, bhz, cl, dtu, dtv, fe2, gol, so4

Details for d3mvxa_

PDB Entry: 3mvx (more details), 1.7 Å

PDB Description: X-ray structure of the reduced NikA/1 hybrid, NikA/1-Red
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3mvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvxa_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikp

SCOPe Domain Coordinates for d3mvxa_:

Click to download the PDB-style file with coordinates for d3mvxa_.
(The format of our PDB-style files is described here.)

Timeline for d3mvxa_: