Lineage for d3mvua_ (3mvu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732897Species Ruegeria sp. [TaxId:292414] [189347] (1 PDB entry)
  8. 2732898Domain d3mvua_: 3mvu A: [181610]
    automated match to d1udda_
    complexed with cl, edo, imd

Details for d3mvua_

PDB Entry: 3mvu (more details), 1.8 Å

PDB Description: crystal structure of a tena family transcription regulator (tm1040_3656) from silicibacter sp. tm1040 at 1.80 a resolution
PDB Compounds: (A:) TenA family transcriptional regulator

SCOPe Domain Sequences for d3mvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvua_ a.132.1.0 (A:) automated matches {Ruegeria sp. [TaxId: 292414]}
msepygkafslmraeaepawraythhafveglkagtlpreaflhylqqdyvflihfsraw
alavvksethsemlaavgtvnalvaeemqlhigiceasgisqealfatreraenlaytrf
vleagysgdlldllaalapcvmgygeigkrltaeatstlygdwidtyggddyqaackavg
tllddalerrlgaeftssprwsrlcqtfhtatelevgfwqmgltp

SCOPe Domain Coordinates for d3mvua_:

Click to download the PDB-style file with coordinates for d3mvua_.
(The format of our PDB-style files is described here.)

Timeline for d3mvua_: