![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Ruegeria sp. [TaxId:292414] [189347] (1 PDB entry) |
![]() | Domain d3mvua_: 3mvu A: [181610] automated match to d1udda_ complexed with cl, edo, imd |
PDB Entry: 3mvu (more details), 1.8 Å
SCOPe Domain Sequences for d3mvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvua_ a.132.1.0 (A:) automated matches {Ruegeria sp. [TaxId: 292414]} msepygkafslmraeaepawraythhafveglkagtlpreaflhylqqdyvflihfsraw alavvksethsemlaavgtvnalvaeemqlhigiceasgisqealfatreraenlaytrf vleagysgdlldllaalapcvmgygeigkrltaeatstlygdwidtyggddyqaackavg tllddalerrlgaeftssprwsrlcqtfhtatelevgfwqmgltp
Timeline for d3mvua_: