![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
![]() | Superfamily a.65.1: Annexin [47874] (2 families) ![]() duplication: consists of four domains of the same fold |
![]() | Family a.65.1.1: Annexin [47875] (10 proteins) |
![]() | Protein Annexin V [47883] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries) |
![]() | Domain d1anxa_: 1anx A: [18161] complexed with ca, so4 |
PDB Entry: 1anx (more details), 1.9 Å
SCOPe Domain Sequences for d1anxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1anxa_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]} qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg dtsgdykkallllcge
Timeline for d1anxa_: