![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
![]() | Superfamily c.133.1: RbsD-like [102546] (2 families) ![]() |
![]() | Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
![]() | Protein automated matches [190962] (7 species) not a true protein |
![]() | Species Bifidobacterium longum [TaxId:391904] [189332] (1 PDB entry) |
![]() | Domain d3mvkg_: 3mvk G: [181602] automated match to d2ob5a1 complexed with gol, na, pge |
PDB Entry: 3mvk (more details), 1.65 Å
SCOPe Domain Sequences for d3mvkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvkg_ c.133.1.0 (G:) automated matches {Bifidobacterium longum [TaxId: 391904]} kgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtv fpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqakna ycviasgesaqyanlilqkgvvf
Timeline for d3mvkg_: