Lineage for d3mvkg_ (3mvk G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923205Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 2923206Protein automated matches [190962] (7 species)
    not a true protein
  7. 2923207Species Bifidobacterium longum [TaxId:391904] [189332] (1 PDB entry)
  8. 2923214Domain d3mvkg_: 3mvk G: [181602]
    automated match to d2ob5a1
    complexed with gol, na, pge

Details for d3mvkg_

PDB Entry: 3mvk (more details), 1.65 Å

PDB Description: the crystal structure of fucu from bifidobacterium longum to 1.65a
PDB Compounds: (G:) protein FucU

SCOPe Domain Sequences for d3mvkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvkg_ c.133.1.0 (G:) automated matches {Bifidobacterium longum [TaxId: 391904]}
kgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtv
fpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqakna
ycviasgesaqyanlilqkgvvf

SCOPe Domain Coordinates for d3mvkg_:

Click to download the PDB-style file with coordinates for d3mvkg_.
(The format of our PDB-style files is described here.)

Timeline for d3mvkg_: