Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: RbsD-like [102546] (2 families) |
Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
Protein automated matches [190962] (6 species) not a true protein |
Species Bifidobacterium longum [TaxId:391904] [189332] (1 PDB entry) |
Domain d3mvkb_: 3mvk B: [181597] automated match to d2ob5a1 complexed with gol, na, pge |
PDB Entry: 3mvk (more details), 1.65 Å
SCOPe Domain Sequences for d3mvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvkb_ c.133.1.0 (B:) automated matches {Bifidobacterium longum [TaxId: 391904]} ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc viasgesaqyanlilqkgvv
Timeline for d3mvkb_: