Lineage for d3mvde_ (3mvd E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082815Protein Histone H3 [47122] (6 species)
  7. 1082816Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1082838Domain d3mvde_: 3mvd E: [181593]
    Other proteins in same PDB: d3mvdb_, d3mvdd_, d3mvdf_, d3mvdh_
    automated match to d1kx5a_
    protein/DNA complex

Details for d3mvde_

PDB Entry: 3mvd (more details), 2.9 Å

PDB Description: Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle
PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3mvde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvde_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseay
lvalfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d3mvde_:

Click to download the PDB-style file with coordinates for d3mvde_.
(The format of our PDB-style files is described here.)

Timeline for d3mvde_: