Lineage for d1avha_ (1avh A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48969Fold a.65: Annexin [47873] (1 superfamily)
  4. 48970Superfamily a.65.1: Annexin [47874] (1 family) (S)
  5. 48971Family a.65.1.1: Annexin [47875] (7 proteins)
  6. 48992Protein Annexin V [47883] (3 species)
  7. 48995Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 49001Domain d1avha_: 1avh A: [18159]

Details for d1avha_

PDB Entry: 1avh (more details), 2.3 Å

PDB Description: crystal and molecular structure of human annexin v after refinement. implications for structure, membrane binding and ion channel formation of the annexin family of proteins

SCOP Domain Sequences for d1avha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avha_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens)}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcgedd

SCOP Domain Coordinates for d1avha_:

Click to download the PDB-style file with coordinates for d1avha_.
(The format of our PDB-style files is described here.)

Timeline for d1avha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avhb_