Lineage for d3mv6m_ (3mv6 M:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 939951Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 939966Species Pseudomonas putida [TaxId:303] [49490] (29 PDB entries)
  8. 939982Domain d3mv6m_: 3mv6 M: [181586]
    Other proteins in same PDB: d3mv6a_, d3mv6b_, d3mv6c_
    automated match to d1ykmb1
    complexed with bme, cl, dhb, fe, gol, so4; mutant

Details for d3mv6m_

PDB Entry: 3mv6 (more details), 1.86 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
PDB Compounds: (M:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3mv6m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mv6m_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d3mv6m_:

Click to download the PDB-style file with coordinates for d3mv6m_.
(The format of our PDB-style files is described here.)

Timeline for d3mv6m_: