| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
| Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries) |
| Domain d3mv4n_: 3mv4 N: [181580] Other proteins in same PDB: d3mv4a_, d3mv4b_, d3mv4c_ automated match to d1ykmb1 complexed with bme, co3, fe, gol, so4; mutant |
PDB Entry: 3mv4 (more details), 1.59 Å
SCOPe Domain Sequences for d3mv4n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv4n_ b.3.6.1 (N:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d3mv4n_: