Class a: All alpha proteins [46456] (290 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (2 families) duplication: consists of four domains of the same fold |
Family a.65.1.1: Annexin [47875] (10 proteins) |
Protein Annexin V [47883] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries) |
Domain d1sava_: 1sav A: [18158] with proline substitution by thioproline complexed with ca |
PDB Entry: 1sav (more details), 2.5 Å
SCOPe Domain Sequences for d1sava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sava_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]} qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg dtsgdykkallllcge
Timeline for d1sava_: