| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) ![]() |
| Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
| Protein automated matches [190702] (5 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (3 PDB entries) |
| Domain d3musb_: 3mus B: [181575] automated match to d1euea_ complexed with hem |
PDB Entry: 3mus (more details), 2 Å
SCOPe Domain Sequences for d3musb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3musb_ d.120.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfed
vghspdaremlkqyyigdvhpndlkpa
Timeline for d3musb_: