Lineage for d3musb_ (3mus B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) 
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) 
Protein automated matches [190702] (5 species)
not a true proteinSpecies Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (3 PDB entries) 
Domain d3musb_: 3mus B: [181575]
automated match to d1euea_
complexed with hem
Details for d3musb_
PDB Entry: 3mus (more details), 2 Å
PDB Description: 2A Resolution Structure of Rat Type B Cytochrome b5
PDB Compounds: (B:) Cytochrome b5 type BSCOPe Domain Sequences for d3musb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3musb_ d.120.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfed
vghspdaremlkqyyigdvhpndlkpa
SCOPe Domain Coordinates for d3musb_:
Click to download the PDB-style file with coordinates for d3musb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3musb_:
- d3musb_ first appeared in SCOPe 2.01
- d3musb_ appears in SCOPe 2.04
- d3musb_ is called d3musb1 in SCOPe 2.06
- d3musb_ appears in the current release, SCOPe 2.08, called d3musb1
View in 3D
