Lineage for d3mupd_ (3mup D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038264Domain d3mupd_: 3mup D: [181573]
    Other proteins in same PDB: d3mupc2
    automated match to d1qbha_
    complexed with smk, zn

Details for d3mupd_

PDB Entry: 3mup (more details), 2.6 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037
PDB Compounds: (D:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3mupd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mupd_ g.52.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

SCOPe Domain Coordinates for d3mupd_:

Click to download the PDB-style file with coordinates for d3mupd_.
(The format of our PDB-style files is described here.)

Timeline for d3mupd_: