SCOPe 2.01: Domain d3mupc_: 3mup C:

Lineage for d3mupc_ (3mup C:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (4 PDB entries)

8. Domain d3mupc_: 3mup C: [181572]
   automated match to d1qbha_
   complexed with smk, zn

Details for d3mupc_

PDB Entry: 3mup, 2.6 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037

PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3mupc_:

Sequence; same for both SEQRES and ATOM records:

>d3mupc_ g.52.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqllst

Timeline for d3mupc_:

• d3mupc_ is new in SCOPe 2.01-stable
  
• d3mupc_ appears in SCOPe 2.02
  
• d3mupc_ appears in the current release, SCOPe 2.08, called d3mupc1