![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein automated matches [190700] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187840] (35 PDB entries) |
![]() | Domain d3mupb_: 3mup B: [181571] automated match to d1qbha_ complexed with smk, zn |
PDB Entry: 3mup (more details), 2.6 Å
SCOPe Domain Sequences for d3mupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mupb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd dpwvehakwfprceflirmkgqefvdeiqgryphlleqll
Timeline for d3mupb_: