Lineage for d3mupa_ (3mup A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067401Protein automated matches [190700] (1 species)
    not a true protein
  7. 1067402Species Human (Homo sapiens) [TaxId:9606] [187840] (4 PDB entries)
  8. 1067405Domain d3mupa_: 3mup A: [181570]
    automated match to d1qbha_
    complexed with smk, zn

Details for d3mupa_

PDB Entry: 3mup (more details), 2.6 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3mupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mupa_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqll

SCOPe Domain Coordinates for d3mupa_:

Click to download the PDB-style file with coordinates for d3mupa_.
(The format of our PDB-style files is described here.)

Timeline for d3mupa_: