Lineage for d1avr__ (1avr -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444876Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 444877Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 444878Family a.65.1.1: Annexin [47875] (8 proteins)
  6. 444903Protein Annexin V [47883] (3 species)
  7. 444906Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 444910Domain d1avr__: 1avr - [18157]

Details for d1avr__

PDB Entry: 1avr (more details), 2.3 Å

PDB Description: crystal and molecular structure of human annexin v after refinement. implications for structure, membrane binding and ion channel formation of the annexin family of proteins

SCOP Domain Sequences for d1avr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avr__ a.65.1.1 (-) Annexin V {Human (Homo sapiens)}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcged

SCOP Domain Coordinates for d1avr__:

Click to download the PDB-style file with coordinates for d1avr__.
(The format of our PDB-style files is described here.)

Timeline for d1avr__: