Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Xylanase [51488] (6 species) |
Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries) intra-cellular xylanase |
Domain d3muia_: 3mui A: [181567] automated match to d1n82a_ complexed with gol, na |
PDB Entry: 3mui (more details), 1.8 Å
SCOPe Domain Sequences for d3muia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muia_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr ykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyne cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhita ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld nfpvhgrknwpllfdeqhkpkpafwravsv
Timeline for d3muia_: