Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family automatically mapped to Pfam PF02569 |
Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species) |
Species Salmonella typhimurium [TaxId:99287] [189346] (1 PDB entry) |
Domain d3mued1: 3mue D:1-282 [181566] Other proteins in same PDB: d3muea2, d3mueb2, d3muec2, d3mued2 automated match to d1ihoa_ complexed with acy, eoh, gol, so4 |
PDB Entry: 3mue (more details), 2.7 Å
SCOPe Domain Sequences for d3mued1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mued1 c.26.1.4 (D:1-282) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Salmonella typhimurium [TaxId: 99287]} mliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvnpm qfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstmleg asrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpiira kdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgfra ddiqirdadtlleltetskravilaaawlgqarlidnqsvtl
Timeline for d3mued1: