SCOPe 2.08: Domain d3muec1: 3mue C:1-282

Lineage for d3muec1 (3mue C:1-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Salmonella typhimurium [TaxId:99287] [189346] (1 PDB entry)

8. Domain d3muec1: 3mue C:1-282 [181565]
   Other proteins in same PDB: d3muea2, d3mueb2, d3muec2, d3mued2
   automated match to d1ihoa_
   complexed with acy, eoh, gol, so4

Details for d3muec1

PDB Entry: 3mue, 2.7 Å

PDB Description: Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium

PDB Compounds: (C:) Pantothenate synthetase

SCOPe Domain Sequences for d3muec1:

Sequence; same for both SEQRES and ATOM records:

>d3muec1 c.26.1.4 (C:1-282) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Salmonella typhimurium [TaxId: 99287]}
mliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvnpm
qfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstmleg
asrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpiira
kdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgfra
ddiqirdadtlleltetskravilaaawlgqarlidnqsvtl

Timeline for d3muec1:

• d3muec1 first appeared in SCOPe 2.01, called d3muec_
  
• d3muec1 appears in SCOPe 2.07