SCOPe 2.01: Domain d3muaa_: 3mua A:

Lineage for d3muaa_ (3mua A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase [51488] (6 species)

7. Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
   intra-cellular xylanase

8. Domain d3muaa_: 3mua A: [181561]
   automated match to d1n82a_
   complexed with act, gol, na, xyp

Details for d3muaa_

PDB Entry: 3mua, 1.5 Å

PDB Description: enzyme-substrate interactions of ixt6, the intracellular xylanase of g. stearothermophilus.

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3muaa_:

Sequence; same for both SEQRES and ATOM records:

>d3muaa_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv

Timeline for d3muaa_:

• d3muaa_ is new in SCOPe 2.01-stable
  
• d3muaa_ appears in SCOPe 2.02
  
• d3muaa_ appears in the current release, SCOPe 2.08