SCOPe 2.06: Domain d1hvfa_: 1hvf A:

Lineage for d1hvfa_ (1hvf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hvfa_: 1hvf A: [18155]
   complexed with ca, so4; mutant

Details for d1hvfa_

PDB Entry: 1hvf, 2 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1hvfa_:

Sequence; same for both SEQRES and ATOM records:

>d1hvfa_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
vlrgtvtdfpgfdgradaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc

Timeline for d1hvfa_:

• d1hvfa_ first appeared (with stable ids) in SCOP 1.55, called d1hvf__
  
• d1hvfa_ appears in SCOPe 2.05
  
• d1hvfa_ appears in SCOPe 2.07
  
• d1hvfa_ appears in the current release, SCOPe 2.08