| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Ubiquitin [54238] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
| Domain d3mtnd1: 3mtn D:1-76 [181549] Other proteins in same PDB: d3mtna_, d3mtnb2, d3mtnc_, d3mtnd2 automated match to d1p3qu_ complexed with cl, gol, zn |
PDB Entry: 3mtn (more details), 2.7 Å
SCOPe Domain Sequences for d3mtnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mtnd1 d.15.1.1 (D:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkwstlflllrlrgg
Timeline for d3mtnd1:
View in 3DDomains from other chains: (mouse over for more information) d3mtna_, d3mtnb1, d3mtnb2, d3mtnc_ |