Lineage for d3mtna_ (3mtn A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015509Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1015510Protein automated matches [190230] (9 species)
    not a true protein
  7. 1015521Species Human (Homo sapiens) [TaxId:9606] [187072] (8 PDB entries)
  8. 1015533Domain d3mtna_: 3mtn A: [181546]
    Other proteins in same PDB: d3mtnb_, d3mtnd_
    automated match to d2ibia1
    complexed with cl, gol, zn

Details for d3mtna_

PDB Entry: 3mtn (more details), 2.7 Å

PDB Description: Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 21

SCOPe Domain Sequences for d3mtna_:

Sequence, based on SEQRES records: (download)

>d3mtna_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal
whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgrrappila
ngpvpspprrggalleepelsdddranlmwkryleredskivdlfvgqlksclkcqacgy
rsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenapvcdrcrqktrstkk
ltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasdkagspvyqlyalcn
hsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfyqlm

Sequence, based on observed residues (ATOM records): (download)

>d3mtna_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal
whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrlsdddranl
mwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslr
dcfnlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsargsikkssv
gvdfplqrlslgdfasspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvse
nqvassegyvlfyqlm

SCOPe Domain Coordinates for d3mtna_:

Click to download the PDB-style file with coordinates for d3mtna_.
(The format of our PDB-style files is described here.)

Timeline for d3mtna_: