SCOPe 2.05: Domain d1hvda_: 1hvd A:

Lineage for d1hvda_ (1hvd A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hvda_: 1hvd A: [18154]
   complexed with ca; mutant

Details for d1hvda_

PDB Entry: 1hvd, 2 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1hvda_:

Sequence; same for both SEQRES and ATOM records:

>d1hvda_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
vlrgtvtdfpgfdgradaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc

Timeline for d1hvda_:

• d1hvda_ first appeared (with stable ids) in SCOP 1.55, called d1hvd__
  
• d1hvda_ appears in SCOPe 2.04
  
• d1hvda_ appears in SCOPe 2.06
  
• d1hvda_ appears in the current release, SCOPe 2.08