SCOP 1.71: Domain d1hvd__: 1hvd -

Lineage for d1hvd__ (1hvd -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (9 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hvd__: 1hvd - [18154]
   complexed with ca; mutant

Details for d1hvd__

PDB Entry: 1hvd, 2 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

SCOP Domain Sequences for d1hvd__:

Sequence; same for both SEQRES and ATOM records:

>d1hvd__ a.65.1.1 (-) Annexin V {Human (Homo sapiens)}
vlrgtvtdfpgfdgradaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc

Timeline for d1hvd__:

• d1hvd__ first appeared (with stable ids) in SCOP 1.55
  
• d1hvd__ appears in SCOP 1.69
  
• d1hvd__ is called d1hvda_ in SCOP 1.73
  
• d1hvd__ appears in the current release, SCOPe 2.08, called d1hvda_