Lineage for d1hvd__ (1hvd -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48969Fold a.65: Annexin [47873] (1 superfamily)
  4. 48970Superfamily a.65.1: Annexin [47874] (1 family) (S)
  5. 48971Family a.65.1.1: Annexin [47875] (7 proteins)
  6. 48992Protein Annexin V [47883] (3 species)
  7. 48995Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 48996Domain d1hvd__: 1hvd - [18154]

Details for d1hvd__

PDB Entry: 1hvd (more details), 2 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

SCOP Domain Sequences for d1hvd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvd__ a.65.1.1 (-) Annexin V {Human (Homo sapiens)}
vlrgtvtdfpgfdgradaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc

SCOP Domain Coordinates for d1hvd__:

Click to download the PDB-style file with coordinates for d1hvd__.
(The format of our PDB-style files is described here.)

Timeline for d1hvd__: