| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein RhoA [52612] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries) Uniprot P61586 2-181 |
| Domain d3msxa_: 3msx A: [181539] Other proteins in same PDB: d3msxb_ automated match to d1cxza_ complexed with gdp, mg, mgf |
PDB Entry: 3msx (more details), 1.65 Å
SCOPe Domain Sequences for d3msxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msxa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
Timeline for d3msxa_: