SCOPe 2.06: Domain d3mssd1: 3mss D:232-498

Lineage for d3mssd1 (3mss D:232-498)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)

8. Domain d3mssd1: 3mss D:232-498 [181538]
   Other proteins in same PDB: d3mssa2, d3mssb2, d3mssc2, d3mssd2
   automated match to d1opjb_
   complexed with ms7, sti

Details for d3mssd1

PDB Entry: 3mss, 1.95 Å

PDB Description: Abl kinase in complex with imatinib and fragment (FRAG2) in the myristate site

PDB Compounds: (D:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3mssd1:

Sequence, based on SEQRES records:

>d3mssd1 d.144.1.7 (D:232-498) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfq

Sequence, based on observed residues (ATOM records):

>d3mssd1 d.144.1.7 (D:232-498) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlveeflkeaavmkeikhpn
lvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameylekk
nfihrdlaarnclvgenhlvkvadfglsrlmgdtytahagakfpikwtapeslaynkfsi
ksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqw
npsdrpsfaeihqafetmfq

Timeline for d3mssd1:

• d3mssd1 first appeared in SCOPe 2.01, called d3mssd_
  
• d3mssd1 was called d3mssd_ in SCOPe 2.05
  
• d3mssd1 appears in SCOPe 2.07
  
• d3mssd1 appears in the current release, SCOPe 2.08