Lineage for d1alaa_ (1ala A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1738983Protein Annexin V [47883] (3 species)
  7. 1738984Species Chicken (Gallus gallus) [TaxId:9031] [47884] (3 PDB entries)
  8. 1738986Domain d1alaa_: 1ala A: [18153]
    complexed with ca

Details for d1alaa_

PDB Entry: 1ala (more details), 2.25 Å

PDB Description: structure of chicken annexin v at 2.25-angstroms resolution
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1alaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alaa_ a.65.1.1 (A:) Annexin V {Chicken (Gallus gallus) [TaxId: 9031]}
kytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktlfg
rdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpaev
qnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrveealvekdaqvlfra
gelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllavvk
cirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmiqk
dtsgdyrkallllcgg

SCOPe Domain Coordinates for d1alaa_:

Click to download the PDB-style file with coordinates for d1alaa_.
(The format of our PDB-style files is described here.)

Timeline for d1alaa_: