Lineage for d1aowa_ (1aow A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000035Protein Annexin IV [47881] (1 species)
  7. 2000036Species Cow (Bos taurus) [TaxId:9913] [47882] (3 PDB entries)
  8. 2000039Domain d1aowa_: 1aow A: [18152]

Details for d1aowa_

PDB Entry: 1aow (more details), 3 Å

PDB Description: annexin iv
PDB Compounds: (A:) annexin IV

SCOPe Domain Sequences for d1aowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aowa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]}
asgfnaaedaqtlrkamkglgtdedaiinvlayrstaqrqeirtaykttigrdlmddlks
elsgnfeqvilgmmtptvlydvqevrkamkgagtdegclieilasrtpeeirrinqtyql
qygrsleddirsdtsfmfqrvlvslsaggrdesnylddalmrqdaqdlyeagekkwgtde
vkfltvlcsrnrnhllhvfdeykriaqkdieqsiksetsgsfedallaivkcmrnksayf
aerlyksmkglgtdddtlirvmvsraeidmldiranfkrlygkslysfikgdtsgdyrkv
llilcggdd

SCOPe Domain Coordinates for d1aowa_:

Click to download the PDB-style file with coordinates for d1aowa_.
(The format of our PDB-style files is described here.)

Timeline for d1aowa_: