SCOPe 2.07: Domain d3mqkc_: 3mqk C:

Lineage for d3mqkc_ (3mqk C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
   stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
   automatically mapped to Pfam PF04410

6. Protein Gar1 homolog PF1791 [141342] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries)
   Uniprot Q8U029 1-73

8. Domain d3mqkc_: 3mqk C: [181494]
   Other proteins in same PDB: d3mqka1, d3mqka2, d3mqkb_
   automated match to d2hvyb1
   protein/RNA complex

Details for d3mqkc_

PDB Entry: 3mqk, 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide

PDB Compounds: (C:) Small nucleolar rnp gar1-like protein

SCOPe Domain Sequences for d3mqkc_:

Sequence; same for both SEQRES and ATOM records:

>d3mqkc_ b.43.3.5 (C:) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvder

Timeline for d3mqkc_:

• d3mqkc_ first appeared in SCOPe 2.01
  
• d3mqkc_ appears in SCOPe 2.06
  
• d3mqkc_ appears in the current release, SCOPe 2.08