SCOPe 2.06: Domain d3mqkb_: 3mqk B:

Lineage for d3mqkb_ (3mqk B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
   Uniprot Q8U1R4 4-55

8. Domain d3mqkb_: 3mqk B: [181493]
   Other proteins in same PDB: d3mqka1, d3mqka2, d3mqkc_
   automated match to d2ey4e1
   protein/RNA complex

Details for d3mqkb_

PDB Entry: 3mqk, 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d3mqkb_:

Sequence; same for both SEQRES and ATOM records:

>d3mqkb_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d3mqkb_:

• d3mqkb_ first appeared in SCOPe 2.01
  
• d3mqkb_ appears in SCOPe 2.05
  
• d3mqkb_ appears in SCOPe 2.07
  
• d3mqkb_ appears in the current release, SCOPe 2.08