Lineage for d3mqkb_ (3mqk B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066818Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
  5. 1066819Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 1066825Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 1066829Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
    Uniprot Q8U1R4 4-55
  8. 1066836Domain d3mqkb_: 3mqk B: [181493]
    Other proteins in same PDB: d3mqkc_
    automated match to d2ey4e1
    protein/RNA complex

Details for d3mqkb_

PDB Entry: 3mqk (more details), 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide
PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d3mqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mqkb_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOPe Domain Coordinates for d3mqkb_:

Click to download the PDB-style file with coordinates for d3mqkb_.
(The format of our PDB-style files is described here.)

Timeline for d3mqkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mqkc_