Lineage for d1axna_ (1axn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000031Protein Annexin III [47879] (1 species)
  7. 2000032Species Human (Homo sapiens) [TaxId:9606] [47880] (2 PDB entries)
  8. 2000033Domain d1axna_: 1axn A: [18149]
    complexed with ca

Details for d1axna_

PDB Entry: 1axn (more details), 1.78 Å

PDB Description: the high resolution structure of annexin iii shows differences with annexin v
PDB Compounds: (A:) annexin III

SCOPe Domain Sequences for d1axna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]}
sasiwvghrgtvrdypdfspsvdaeaiqkairgigtdekmlisiltersnaqrqlivkey
qaaygkelkddlkgdlsghfehlmvalvtppavfdakqlkksmkgagtnedalieilttr
tsrqmkdisqayytvykkslgddissetsgdfrkalltladgrrdeslkvdehlakqdaq
ilykagenrwgtdedkfteilclrsfpqlkltfdeyrnisqkdivdsikgelsghfedll
laivncvrntpaflaerlhralkgigtdeftlnrimvsrseidlldirtefkkhygysly
saiksdtsgdyeitllkicggdd

SCOPe Domain Coordinates for d1axna_:

Click to download the PDB-style file with coordinates for d1axna_.
(The format of our PDB-style files is described here.)

Timeline for d1axna_: