Lineage for d1axna1 (1axn A:3-324)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717106Protein Annexin III [47879] (1 species)
  7. 2717107Species Human (Homo sapiens) [TaxId:9606] [47880] (2 PDB entries)
  8. 2717108Domain d1axna1: 1axn A:3-324 [18149]
    Other proteins in same PDB: d1axna2
    complexed with ca

Details for d1axna1

PDB Entry: 1axn (more details), 1.78 Å

PDB Description: the high resolution structure of annexin iii shows differences with annexin v
PDB Compounds: (A:) annexin III

SCOPe Domain Sequences for d1axna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axna1 a.65.1.1 (A:3-324) Annexin III {Human (Homo sapiens) [TaxId: 9606]}
asiwvghrgtvrdypdfspsvdaeaiqkairgigtdekmlisiltersnaqrqlivkeyq
aaygkelkddlkgdlsghfehlmvalvtppavfdakqlkksmkgagtnedalieilttrt
srqmkdisqayytvykkslgddissetsgdfrkalltladgrrdeslkvdehlakqdaqi
lykagenrwgtdedkfteilclrsfpqlkltfdeyrnisqkdivdsikgelsghfedlll
aivncvrntpaflaerlhralkgigtdeftlnrimvsrseidlldirtefkkhygyslys
aiksdtsgdyeitllkicggdd

SCOPe Domain Coordinates for d1axna1:

Click to download the PDB-style file with coordinates for d1axna1.
(The format of our PDB-style files is described here.)

Timeline for d1axna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axna2