Lineage for d3mpoc_ (3mpo C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149542Species Lactobacillus brevis [TaxId:387344] [189330] (1 PDB entry)
  8. 2149545Domain d3mpoc_: 3mpo C: [181487]
    automated match to d1rkqa_

Details for d3mpoc_

PDB Entry: 3mpo (more details), 2.9 Å

PDB Description: The crystal structure of a hydrolase from Lactobacillus brevis
PDB Compounds: (C:) Predicted hydrolase of the HAD superfamily

SCOPe Domain Sequences for d3mpoc_:

Sequence, based on SEQRES records: (download)

>d3mpoc_ c.108.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 387344]}
tikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamdidg
ddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdi
saytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvq
sapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaid
evkeaaqavtltnaengvaaairkyal

Sequence, based on observed residues (ATOM records): (download)

>d3mpoc_ c.108.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 387344]}
tikliaididaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitfng
svaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaesyl
vrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfievmn
rraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaidevkeaaqavt
ltnaengvaaairkyal

SCOPe Domain Coordinates for d3mpoc_:

Click to download the PDB-style file with coordinates for d3mpoc_.
(The format of our PDB-style files is described here.)

Timeline for d3mpoc_: