SCOPe 2.05: Domain d3mpob_: 3mpo B:

Lineage for d3mpob_ (3mpo B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Lactobacillus brevis [TaxId:387344] [189330] (1 PDB entry)

8. Domain d3mpob_: 3mpo B: [181486]
   automated match to d1rkqa_

Details for d3mpob_

PDB Entry: 3mpo, 2.9 Å

PDB Description: the crystal structure of a hydrolase from lactobacillus brevis

PDB Compounds: (B:) Predicted hydrolase of the HAD superfamily

SCOPe Domain Sequences for d3mpob_:

Sequence; same for both SEQRES and ATOM records:

>d3mpob_ c.108.1.0 (B:) automated matches {Lactobacillus brevis [TaxId: 387344]}
tikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamdidg
ddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdi
saytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvq
sapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaid
evkeaaqavtltnaengvaaairkya

Timeline for d3mpob_:

• d3mpob_ first appeared in SCOPe 2.01
  
• d3mpob_ appears in SCOPe 2.04
  
• d3mpob_ appears in SCOPe 2.06
  
• d3mpob_ appears in the current release, SCOPe 2.08